Index 
Search
Download
Help
ASC_00433: Thyroid hormone receptor alpha
ID:

ASC_00433
AC:

433
CL:

ASC
DT:

28-JUN-2004 (Rel. 2.2, created)
NA:

Thyroid hormone receptor alpha
C-erbA-alpha
c-erbA-1
GN:

THRA
NR1A1
C-ERBA-ALPHA
OS:

Mus musculus (Mouse), Rattus norvegicus (Rat)
P1:

12890568 (2003)
P2:

12890568 (2003)
SP:

THA_MOUSE, P15827
SS:

SWISSPROT/TrEMBL
SI:

492 AA; 55071 Da; calculated pI: 6.91
SQ:

MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCPLKSSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHVATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI
PHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQF
GEAGSLRGPVLQHQSPKSPQQRLLELLHRSGILHSRAVCGEDDSSEASSLSSSSSDEDTE
VFEDLAGKAASP

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab