Index 
Search
Download
Help
ASC_00431: Phosphatase and actin regulator 3
ID:

ASC_00431
AC:

431
CL:

ASC
DT:

28-JUN-2004 (Rel. 2.2, created)
NA:

Phosphatase and actin regulator 3
Scapinin
Scaffold-associated PP1 inhibiting protein
GN:

PHACTR3
SCAPIN1
C20ORF101
OS:

Homo sapiens (Human)
P1:

12925532 (2003)
P2:

12925532 (2003)
SP:

PHR3_HUMAN, Q96KR7
SS:

SWISSPROT/TrEMBL
SI:

559 AA; 62552 Da; calculated pI: 9.27
SQ:

MAASEDGSGCLVSRGRSQSDPSVLTDSSATSSADAGENPDEMDQTPPARPEYLVSGIRTP
PVRRNSKLATLGRIFKPWKWRKKKNEKLKQTTSALEKKMAGRQGREELIKKGLLEMMEQD
AESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDDA
AKMPSASSGEEADAGSLLPTTNELSQALAGADSLDSPPRPLERSVGQLPSPPLLPTPPPK
ASSKTTKNVTGQATLFQASSMKSADPSLRGQLSTPTGSPHLTTVHRPLPPSRVIEELHRA
LATKHRQDSFQGRESKGSPKKRLDVRLSRTSSVERGKEREEAWSFDGALENKRTAAKESE
ENKENLIINSELKDDLLLYQDEEALNDSIISGTLPRKCKKELLAVKLRNRPSKQELEDRN
IFPRRTDEERQEIRQQIEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLT
RKLNQRPTVDELRDRKILIRFSDYVEVAKAQDYDRRADKPWTRLSAADKAAIRKELNEYK
SNEMEVHASSKHLTRFHRP

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab