Index 
Search
Download
Help
ASC_00426: RA-regulated nuclear matrix-associated protein
ID:

ASC_00426
AC:

426
CL:

ASC
DT:

28-JUN-2004 (Rel. 2.2, created)
NA:

RA-regulated nuclear matrix-associated protein
GN:

RAMP
2810047L02RIK
OS:

Mus musculus (Mouse)
P1:

14611667 (2003)
P2:

14611667 (2003)
SP:

Q80WY2
SS:

SWISSPROT/TrEMBL
SI:

729 AA; 79161 Da; calculated pI: 9.08
SQ:

MLFNSVLRQPQLGVLRNGWSSHYPLQSLLSGYQCNCNDEHTSYGETGVPVPPFGCTFCTA
PSMEHILAVANEEGFVRLYNTESQTSKKTCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQ
TAKFWDVRAGELMGTCKGHQCSLKSVAFPKFQKAVFSTGGRDGNIMIWDTRCNKKDGFYR
QVNQISGAHNTADKQTPSKPKKKQNSKGLAPAVDSQQSVTVVLFQDENTLVSAGAVDGII
KVWDLRKNYTAYRQEPIASKSFLYPGTSTRKLGYSSLVLDSTGSTLFANCTDDNIYMFNT
TGLKTSPVAVFNGHQNSTFYVKSSLSPDDQFLISGSSDEAAYIWKVSMPWHPPTVLLGHS
QEVTSVCWYPSDFTKIATCSDDNTLKIWRLNRGLEEKPGDKHSIVGWTSQKKKEVKACPV
TVPSSQSTPAKAPRAKSSPSISSPSSAACTPSCAGDLPLPSSTPTFSVKTTPATTRSSVS
RRGSISSVSPKPLSSFKMSLRNWVTRTPSSSPPVTPPASETKISSPRKALIPVSQKSSQA
DACSESRNRVKRRLDSSCLESVKQKCVKSCNCVTELDGQAESLRLDLCCLSGTQEVLSQD
SEGPTKSSKTEGAGTSISEPPSPVSPYASEGCGPLPLPLRPCGEGSEMVGKENSSPENKN
WLLAIAAKRKAENSSPRSPSSQTPSSRRQSGKTSPGPVTITPSSMRKICTYFRRKTQDDF
CSPEHSTEL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab