Index 
Search
Download
Help
ASC_00420: Nuclear protein SkiP
ID:

ASC_00420
AC:

420
CL:

ASC
DT:

28-JUN-2004 (Rel. 2.2, created)
NA:

Nuclear protein SkiP
Ski-interacting protein
SNW1 protein
Nuclear receptor coactivator NCoA-62
GN:

SNW1
SKIP
OS:

Homo sapiens (Human)
P1:

15052407 (2004)
P2:

15052407 (2004)
SP:

SNW1_HUMAN, Q13573
SS:

SWISSPROT/TrEMBL
SI:

536 AA; 61494 Da; calculated pI: 9.52
SQ:

MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGD
GGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLV
PKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYT
PSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVK
EQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKARE
AVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRR
KERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDS
GFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSG
SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab