Index 
Search
Download
Help
ASC_00418: Autoimmune regulator
ID:

ASC_00418
AC:

418
CL:

ASC
DT:

28-JUN-2004 (Rel. 2.2, created)
NA:

Autoimmune regulator
Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein
APECED protein
GN:

AIRE
APECED
OS:

Homo sapiens (Human)
P1:

15150263 (2004)
P2:

15150263 (2004)
SP:

AIRE_HUMAN, O43918
SS:

SWISSPROT/TrEMBL
SI:

545 AA; 57726 Da; calculated pI: 7.53
SQ:

MATDAALRRLLRLHRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFH
ALLSWLLTQDSTAILDFWRVLFKDYNLERYGRLQPILDSFPKDVDLSQPRKGRKPPAVPK
ALVPPPRLPTKRKASEEARAAAPAALTPRGTASPGSQLKAKPPKKPESSAEQQRLPLGNG
IQTMSASVQRAVAMSSGDVPGARGAVEGILIQQVFESGGSKKCIQVGGEFYTPSKFEDSG
SGKNKARSSSGPKPLVRAKGAQGAAPGGGEARLGQQGSVPAPLALPSDPQLHQKNEDECA
VCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAEEPRPQEP
PVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCV
GPEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVT
PAPVEGVLAPSPARLAPGPAKDDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPA
APFPS

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab