Index 
Search
Download
Help
ASC_00416: Protein disulfide isomerase
ID:

ASC_00416
AC:

416
CL:

ASC
DT:

28-JUN-2004 (Rel. 2.2, created)
NA:

Protein disulfide isomerase
PDI
Prolyl 4-hydroxylase beta subunit
Cellular thyroid hormone binding protein
p55
GN:

P4HB
PDIA1
PDI
PO4DBNA
Duo1p-interacting protein
OS:

Homo sapiens (Human)
P1:

15195517 (2004)
P2:

15195517 (2004)
SP:

PDI_HUMAN, P07237
PD:

1BJX, 1MEK, 2BJX
SS:

SWISSPROT/TrEMBL
SI:

508 AA; 57116 Da; calculated pI: 4.76
SQ:

MLRRALLCLAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALA
PEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGR
EADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAID
DIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEF
TEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQR
ILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQEL
PEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENI
VIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGD
DDDLEDLEEAEEPDMEEDDDQKAVKDEL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab