Index 
Search
Download
Help
ASC_00412: Zinc finger protein 326
ID:

ASC_00412
AC:

412
CL:

ASC
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Zinc finger protein 326
GN:

Zfp326
ZAN75
5730470H14Rik
Mm.12891
OS:

Homo sapiens (Human)
P1:

9809746 (1998)
P2:

9809746 (1998)
CC:

protein found in www.incyte.com-database
SS:

GenBank
SI:

580 AA; 65192 Da; calculated pI: 5.09
SQ:

MDFEDDYVHSTCRGAYQDFNGMDRDYGPGSYGGLDRDYGHGSYGGQRSMDSYLNQSYGMD
NHSGGGGGSRFGPYESYDSRSSLGGRDLYRSGYGFNEPEQTRFGGSYGGRFESSYRNSLD
SFGGRNQGGSSWEAPYSRSKLRPGFMEDRGRENYSSYSSFSSPHMKPAPVGSRGRGTPAY
PESTFGSRSYDAFGGPSTGRGRGRGHMGDFGSFHRPGIIVDYQNKPANVTIATARGIKRK
MMQIFIKPGGAFIKKPKLAKPMDKMNLSKSPTKTDPKNEEEEKRRIEARREKQRRRREKN
SEKYGDGYRMAFTCSFCKFRTFEEKDIELHLESSSHQETLDHIQKQTKFDKVVMEFLHEC
MVNKFKKASIRKQQTLNHPEAYKIIEKDIMEGVTADDHMMKVETVHCSACSVYIPALHSS
VQLHLKSPDHSKGKQAYKEQIKRESVLTATSILNNPIVKARYERFVKGENPFEIQDHPQD
QQIEGDEEDEEKIDEPIEEEEEEEEEEEEEGEEAGSVEEEGDVEGEEGTAEAAAAGEADA
VGEAEGAGEAEEAEEEEEEEGTQEFAAQACATEQCEHRQM

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab