Index 
Search
Download
Help
ASC_00409: Msx2 interacting nuclear target protein
ID:

ASC_00409
AC:

409
CL:

ASC
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Msx2 interacting nuclear target protein
GN:

Mint
LOC56381
Mm.32415
OS:

Homo sapiens (Human)
P1:

10451362 (1999)
P2:

10451362 (1999), 15131132 (2004)
CC:

protein found in www.incyte.com-database
SS:

GenBank
SI:

3576 AA; 390983 Da; calculated pI: 8.60
SQ:

MGDRDLRTDYNEPGTIPSAARGLDETVSIASRSREVSGFRGSAGGPAYGPPPSLHAREGR
YERRLDGASDNRERAYEHSAYGHHERGTGAFDRTRHYDQDYYRDPRERTLQHGLYYTSRS
RSPNRFDAHDPRYEPRAREQFTLPSVVHRDIYRDDITREVRGRRPERSYQHSRSRSPHSS
QSRNQSPQRLASQASRPTRSPSGSGSRSRSSSSDSISSSSSSSNTDSSDSSSTASDDSPA
RSVQSAAVPAPTSQLLSSLEKDEPRKSFGIKVQNLPVRSIDTSLKDGLFHEFKKFGKVTS
VQIHGASEERYGLVFFRQQEDQEKALTASKGKLFFGMQIEVTAWVGPETESENEFRPLDE
RIDEFHPKATRTLFIGNLEKTTTYHDLRNIFQRFGEIVDIDIKKVNGVPQYAFLQYCDIA
SVCKAIKKMDGEYLGNNRLKLGFGKSMPTNCVWLDGLSSNVSDQYLTRHFCRYGPVVKVV
FDRLKGMALVLYSEIEDAQAAVKETKGRKIGGNKIKVDFANRESQLAFYHCMEKSGQDMR
DFYEMLTERRAGQMAQSKHEDWSADAQSPHKCREERRGSYEYSQERTYYENVRTPGTYPE
DSRRDYPARGREFYSEWETYQGEYYDSRYYDEPREYREYRSDPYEQDIREYSYRQRERER
ERERFESDRDHERRPIERSQSPVHLRRPQSPGVSPAHSERLPSDSERRLYRRSSERSGSC
SSVSPPRYDKLEKARLERYTKNEKADKERTFDPERVERERRIVRKEKGEKDKAERQKRKG
KAHSPSSQPSETEQENDREQSPEKPRGSTKLSRDRADKEGPAKNRLELVPCVVLTRVKEK
EGKVIEHPPPEKLKARLGRDTTKASALDQKPQAAQGEPAKSDPARGKALREKVLPSHAEV
GEKEGRTKLRKHLKAEQTPELSALDLEKLEARKRRFADSGLKIEKQKPEIKKTSPETEDT
RILLKKQPDTSRDGVLLREGESERKPVRKEILKRESKKTKLERLNSALSPKDCQDPAAVS
AGSGSRPSSDVHAGLGELTHGSVETQETQPKKAIPSKPQPKQLQLLENQGPEKEEVRKNY
CRPREEPAEHRAGQEKPHGGNAEEKLGIDIDHTQSYRKQMEQSRRKQRMEMEIAKAEKFG
SPKKDVDDYERRSLVHEVGKPPQDVTDDSPPSKKRRTDHVDFDICTKRERNYRSSRQISE
DSERTSCSPSVRHGSFHDDDDPRGSPRLVSVKGSPKGDEKGLPYPNAAVRDDPLKCNPYD
SGKREQTADTAKIKLSVLNSEGEPSRWDPPMKQDPSRFDVSFPNSVIKRDSLRKRSVRDL
EPGEVPSDSDEDAEHRSQSPRASSFYDSPRLSFLLRDRDQKLRERDERLASSLERNKFYS
FALDKTITPDTKALLERAKSLSSSREENWSFLDWDSRFANFRNNKDKEKVDSAPRPIPSW
YMKKKKIRTDSEGKLDDKKDERREEEQERQELFASRFLHSSIFEQDSKRLQHLERKSEES
DFPPGRLYGRQASEGANSTSDSVQEPVVLFHSRFMELTRMQQKEKEKDQKPKEAEKQEEP
ETHPKTPEPAAETKEPEPKAPVSAGLPAVTITVVTPEPASSAPEKAEEAAEAPSPAGEKP
AEPAPVSEETKLVSEPVSVPVEQPRQSDVPPGEDSRDSQDSAALAPSAPQESAATDAVPC
VNAEPLTPGTTVSQVESSVDPKPSSPQPLSKLTQRSEEAEEGKVEKPDTTPSTEPDATQN
AGVASEAQPPASEDVEANPPVAAKDRKTNKSKRSKTSVQAAAASVVEKPVTRKSERIDRE
KLKRSSSPRGEAQKLLELKMEAEKITRTASKSSGGDTEHPEPSLPLSRSRRRNVRSVYAT
MTDHESRSPAKEPVEQPRVTRKRLERELQEAVVPPTTPRRGRPPKTRRRAEEDGEHERKE
PAETPRPAEGWRSPRSQKSAAAAGPQGKRGRNEQKVEAAAEAGAQASTREGNPKSRGERE
AASEPKRDRRDPSTDKSGPDTFPVEVLERKPPEKTYKSKRGRARSTRSGMDRAAHQRSLE
MAARAAGQAADKEAGPAAASPQESESPQKGSGSSPQLANNPADPDREAEEESASASTAPP
EGTQLARQIELEQAVQNIAKLPEPSAAAASKGTATATATAASEEPAPEHGHKPAHQASET
ELAAAIGSIISDASGEPENFSAPPSVPPGSQTHPREGMEPGLHEAESGILETGTATESSA
PQVSALDPPEGSADTKETRGNSGDSVQEAKGSKAEVTPPRKDKGRQKTTRRRKRNANKKV
VAITETRASEAEQTQSESPAAEEATAATPEAPQEEKPSEKPPSPPAECTFDPSKTPPAES
LSQENSAAEKTPCKAPVLPALPPLSQPALMDDGPQARFKVHSIIESDPVTPPSDSGIPPP
TIPLVTIAKLPPPVIPGGVPHQSPPPKVTEWITRQEEPRAQSTPSPALPPDTKASDMDTS
SSTLRKILMDPKYVSATGVTSTSVTTAIAEPVSAPCLQEAPAPPCDPKHPPLEGVSAAAV
PNADTQASEVPVAADKEKVAPVIAPKITSVISRMPVSIDLENSQKITLAKPAPQTLTGLV
SALTGLVNVSLVPVNALKGPVKGSVATLKGLVSTPAGPVNLLKGPVNVLTGPVNVLTTPV
SATVGTVNAAPGPVTAACGVTATTGTAAVTGAVTAPAAKGKQRASSNENSRFHPGSMSVI
DDRPADTGSGAGLRVNTSEGVVLLSYSGQKTEGPQRISAKISQIPPASAMDIEFQQSVSK
SQVKADSITPTQSAPKGPQTPSAFANVAAHSTLVLTAQTYNASPVISSVKTDRPSLEKPE
PIHLSVSTPVTQGGTVKVLTQGINTPPVLVHNQLVLTPSIVTTNKKLADPVTLKIETKVL
QPANLGPTLTPHHPPALPSKLPAEVNHVPSGPSTPADRTIAHLATPKPDTHSPRPTGPTP
GLFPRPCHPSSTTSTALSTNATVMLAAGIPVPQFISSIHPEQSVIMPPHSITQTVSLGHL
SQGEVRMSTPTLPSITYSIRPETLHSPRAPLQPQQIEARAPQRVGTPQPATTGVPALATQ
HPPEEEVHYHLPVARAAAPVQSEVLVMQSEYRLHPYTVPRDVRIMVHPHVTAVSEQPRAT
EGVVKVPPANKAPQQLVKEAVKTSDAKAVPAPAPVPVPVPVPTPAPPPHGEARILTVTPS
SQLQGLPLTPPVVVTHGVQIVHSSGELFQEYRYGDVRTYHAPAQQLTHTQFPVASSISLA
SRTKTSAQVPPEGEPLQSTQSAQPAPSTQATQPIPPAPPCQPSQLSQPAQPPSGKIPQVS
QEAKGTQTGGVEQTRLPAIPTNRPSEPHAQLQRAPVETAQPAHPSPVSVSMKPDLPSPLS
SQAAPKQPLFVPANSGPSTPPGLALPHAEVQPAPKQESSPHGTPQRPVDMVQLLKKYPIV
WQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLSEGGPPLRIAQRMRLEASQLEGVARRMT
VETDYCLLLALPCGRDQEDVVSQTESLKAAFITYLQAKQAAGIINVPNPGSNQPAYVLQI
FPPCEFSESHLSRLAPDLLASISNISPHLMIVIASV

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab