Index 
Search
Download
Help
ASC_00401: Ser-Arg related nuclear matrix protein
ID:

ASC_00401
AC:

401
CL:

ASC
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Ser-Arg related nuclear matrix protein
GN:

SRRM1
SRM160
160-KD
POP101
OS:

Homo sapiens (Human)
P1:

11124967 (2000), 12944400 (2003)
P2:

11124967 (2000), 12944400 (2003)
CC:

protein found in www.incyte.com-database
SS:

GenBank
SI:

820 AA; 93671 Da; calculated pI: 11.92
SQ:

MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL
GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP
SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRERSRSPRRRKSRSP
SPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKEKTPELPEPSVKVKEPSVQEATS
TSDILKVPKPEPIPEPKEPSPEKNSKKEQEKEKTRPRSRSRSKSRSRTRSRSPSHTRPRR
RHRSDKMYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPVRRRRRSSASLSGSSSS
SSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHRPSPPATPPKTRDSPTPQQSNR
TRKSRVSVSPGRTSGKVTKHKGTEKRESPSPAPKPRKVELSESEEDKGGKMAAADSVQQR
RQYRRQNQQSSSDSGSSSSSEDERPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKETSP
RGRRRRSPSPPPTRRRRSPSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSPPIQR
RYSPSPPPKRRTASPPPPPKRRASPSPPPKRRVSHSPPPKQRSSPVTKRRSPSLSSKHRK
GSSPSRSTREARSPQPNKRHSPSPRPRAPQTSSSPPPVRRGASSSPQRRQSPSPSTRPIR
RVSRTPEPKKIKKAASPSPQSVRRVSSSRSVSGSPEPAAKKPPAPPSPVQSQSPSTNWSP
AVPVKKAKKPNTEPITAKKFRSGRRWKEKEEKEGQETQKG

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab