Index 
Search
Download
Help
ASC_00397: Lung carcinoma derived v-myc myelocytomatosis viral oncogene homolog (avian) 1
ID:

ASC_00397
AC:

397
CL:

ASC
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Lung carcinoma derived v-myc myelocytomatosis viral oncogene homolog (avian) 1
GN:

MYCL1
LMYC
MYCL
Hs.169252
LOC112467
OS:

Homo sapiens (Human)
P1:

3054516 (1988)
P2:

3054516 (1988)
CC:

protein found in www.incyte.com-database
SS:

GenBank
SI:

206 AA; 21742 Da; calculated pI: 5.24
SQ:

MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGP
PEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRG
NPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSGKDLPEPSKRGPPHG
WPKLCPCLRSGIGSSQALGPSPPLFG

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab