Index 
Search
Download
Help
ASC_00389: DNA43 protein
ID:

ASC_00389
AC:

389
CL:

ASC
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

DNA43 protein
GN:

DNA43
MCM10
YIL150C
OS:

Saccharomyces cerevisiae (Baker's yeast)
P1:

11168584 (2000)
P2:

11168584 (2000)
CC:

protein found in www.incyte.com-database
SP:

DN43_YEAST, P32354
SS:

SWISSPROT/TrEMBL
SI:

571 AA; 65740 Da; calculated pI: 9.67
SQ:

MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA
IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA
KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH
EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT
KVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDM
LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI
QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK
RSHREEVWQKHFGSKETKETSDGSASDLEII

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab