Index 
Search
Download
Help
ASC_00387: Galectin-3
ID:

ASC_00387
AC:

387
CL:

ASC
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Galectin-3
Galactose-specific lectin 3
MAC-2 antigen
IgE-binding protein
35 kDa lectin
Carbohydrate binding protein 35
CBP 35
Laminin-binding protein
Lectin L-29
GN:

LGALS3
OS:

Rattus norvegicus (Rat)
P1:

11162637 (2001)
P2:

11162637 (2001)
CC:

protein found in www.incyte.com-database
SP:

LEG3_RAT, P08699
SS:

SWISSPROT/TrEMBL
SI:

261 AA; 27040 Da; calculated pI: 8.62
SQ:

ADGFSLNDALAGSGNPNPQGWPGAWGNQPGAGGYPGASYPGAYPGQAPPGGYPGQAPPSA
YPGPTGPSAYPGPTAPGAYPGPTAPGAFPGQPGGPGAYPSAPGAYPSAPGAYPATGPFGA
PTGPLTVPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNENNRR
VIVCNTKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLR
EISQLGIIGDITLTSASHAMI

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab