Index 
Search
Download
Help
ASC_00380: Histone deacetylase 1
ID:

ASC_00380
AC:

380
CL:

ASC
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Histone deacetylase 1
HD1
GN:

HDAC1
OS:

Mus musculus (Mouse)
P1:

10973986 (2000)
P2:

10973986 (2000)
CC:

protein found in www.incyte.com-database
SP:

HDA1_MOUSE, O09106
SS:

SWISSPROT/TrEMBL
SI:

482 AA; 55013 Da; calculated pI: 5.31
SQ:

MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab