Index 
Search
Download
Help
ASC_00378: Casein kinase II, alpha chain
ID:

ASC_00378
AC:

378
CL:

ASC
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Casein kinase II, alpha chain
CK II
GN:

CSNK2A1
CKIIA
OS:

Mus musculus (Mouse)
P1:

11069898 (2000)
P2:

11069898 (2000)
CC:

protein found in www.incyte.com-database
SP:

KC21_MOUSE, Q60737
SS:

SWISSPROT/TrEMBL
SI:

391 AA; 45110 Da; calculated pI: 7.79
SQ:

MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTVREAMEHPFFYTVVKNQARMSSTSMAGGSTPVSSANMMSGISSVPS
PSPLGPLAGSPVIAAANSLGIPVQAAAGAQQ

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab