Index 
Search
Download
Help
ASC_00376: Protein CBFA2T1
ID:

ASC_00376
AC:

376
CL:

ASC
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Protein CBFA2T1
MTG8 protein
GN:

CBFA2T1
CBFA2T1H
MTG8
OS:

Mus musculus (Mouse)
P1:

10973986 (2000)
P2:

10973986 (2000)
CC:

protein found in www.incyte.com-database
SP:

MTG8_MOUSE, Q61909
SS:

SWISSPROT/TrEMBL
SI:

577 AA; 64266 Da; calculated pI: 7.13
SQ:

MPDRTEKHSTMPDSPVDVKTQSRLTPPAMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTAL
NGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGER
VRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNP
AQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRP
CTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRN
RPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADRE
ELNYWIRRYSDAEDLKKGGSSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWK
KAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQ
QEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAPQQGDTPAVS
SSVTPSSGAGSPMDTPPAATPRSTTPGTPSTIETTPR

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab