Index 
Search
Download
Help
ASC_00374: Transducin-like enhancer protein 2
ID:

ASC_00374
AC:

374
CL:

ASC
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Transducin-like enhancer protein 2
ESG2
GN:

TLE2
OS:

Homo sapiens (Human)
P1:

10825294 (2000)
P2:

10825294 (2000)
CC:

protein found in www.incyte.com-database
SP:

TLE2_HUMAN, Q04725
SS:

SWISSPROT/TrEMBL
SI:

743 AA; 79751 Da; calculated pI: 6.16
SQ:

MYPQGRHPTPLQSGQPFKFSILEICDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHY
VMYYEMSYGLNIEMHKQAEIVKRLSGICAQIIPFLTQEHQQQVLQAVERAKQVTVGELNS
LIGQQLQPLSHHAPPVPLTPRPAGLVGGSATGLLALSGALAAQAQLAAAVKEDRAGVEAE
GSRVERAPSRSASPSPPESLVEEERPSGPGGGGKQRADEKEPSGPYESDEDKSDYNLVVD
EDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLGSPLPRAKELILNDLPASTPA
SKSCDSSPPQDASTPGPSSASHLCQLAAKPAPSTDSVALRSPLTLSSPFTTSFSLGSHST
LNGDLSVPSSYVSLHLSPQVSSSVVYGRSPVMAFESHPHLRGSSVSSSLPSIPGGKPAYS
FHVSADGQMQPVPFPSDALVGAGIPRHARQLHTLAHGEVVCAVTISGSTQHVYTGGKGCV
KVWDVGQPGAKTPVAQLDCLNRDNYIRSCKLLPDGRSLIVGGEASTLSIWDLAAPTPRIK
AELTSSAPACYALAVSPDAKVCFSCCSDGNIVVWDLQNQTMVRQFQGHTDGASCIDISDY
GTRLWTGGLDNTVRCWDLREGRQLQQHDFSSQIFSLGHCPNQDWLAVGMESSNVEILHVR
KPEKYQLHLHESCVLSLKFASCGRWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDI
SRNNKYIVTGSGDKKATVYEVVY

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab