Index 
Search
Download
Help
ASC_00367: Double-strand-break repair protein rad21 homolog
ID:

ASC_00367
AC:

367
CL:

ASC
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Double-strand-break repair protein rad21 homolog
hHR21
Nuclear matrix protein 1
NXP-1
SCC1 homolog
GN:

RAD21
HR21
NXP1
KIAA0078
OS:

Homo sapiens (Human)
P1:

10623634 (2000)
P2:

10623634 (2000)
CC:

protein found in www.incyte.com-database
SP:

RA21_HUMAN, O60216
SS:

SWISSPROT/TrEMBL
SI:

631 AA; 71609 Da; calculated pI: 4.54
SQ:

MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLL
LGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQP
LPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQENDFGDFGMDDREIMREGSAFEDD
DMLVSTTTSNLLLESEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGG
IFDDPPALSEAGVMLPEQPAHDDMDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNE
EEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKL
MMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF
ENPEVPREDQQQQHQQRDVIDEPIIEEPSRLQESVMEASRTNIDESAMPPPPPQGVKRKA
GQIDPEPVMPPQQVEQMEIPPVELPPEEPPNICQLIPELELLPEKEKEKEKEKEDDEEEE
DEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSF
LVLKKQQAIELTQEEPYSDIIATPGPRFHII

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab