Index 
Search
Download
Help
ASC_00366: Hypothetical protein KIAA0136 [Fragment]
ID:

ASC_00366
AC:

366
CL:

ASC
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Hypothetical protein KIAA0136 [Fragment]
GN:

KIAA0136
OS:

Homo sapiens (Human)
P1:

11927593 (2002)
P2:

11927593 (2002)
CC:

this NMTS is a close homologue (hssp >= 10) to NMTS found in literature
SP:

Y136_HUMAN, Q14149
SS:

SWISSPROT/TrEMBL
SI:

950 AA; 108180 Da; calculated pI: 5.48
SQ:

GGRSWLCSSLKMAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQ
IWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKLTMNGHVPVGLYGNGFKSGSM
RLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAI
LEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEIT
GKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDV
YRPKFLSKTVRITFGFNCRNKDHYGIMMYHRNRLIKAYEKVGCQLRANNMGVGVVGIIEC
NFLKPTHNKQDFDYTNEYRLTITALGEKLNDYWNEMKVKKNTEYPLNLPVEDIQKRPDQT
WVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPEDEDLVHPTYEKTYKKT
NKEKFRIRQPEMIPRINAELLFRPTALSTPSFSSPKESVPRRHLSEGTNSYATRLLNNHQ
VPPQSEPESNSLKRRLSTRSSILNAKNRRLSSQFENSVYKGDDDDEDVIILEENSTPKPA
VDHDIDMKSEQSHVEQGGVQVEFVGDSEPCGQTGSTSTSSSRCDQGNTAATQTEVPSLVV
KKEETVEDEIDVRNDAVILPSCVEAEAKIHETQETTDKSADDAGCQLQELRNQLLLVTEE
KENYKRQCHMFTDQIKVLQQRILEMNDKYVKKETCHQSTETDAVFLLESINGKSESPDHM
VSQYQQALEEIERLKKQCSALQHVKAECSQCSNNESKSEMDEMAVQLDDVFRQLDKCSIE
RDQYKSEVELLEMEKSQIRSQCEELKTEVEQLKSTNQQTATDVSTSSNIEESVNHMDGES
LKLRSLRVNVGQLLAMIVPDLDLQQVNYDVDVVDEILGQVVEQMSEISST

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab