Index 
Search
Download
Help
ASC_00358: Eukaryotic initiation factor 4A-like NUK-34
ID:

ASC_00358
AC:

358
CL:

ASC
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Eukaryotic initiation factor 4A-like NUK-34
GN:

DDX48
KIAA0111
OS:

Homo sapiens (Human)
P1:

10623621 (2000)
P2:

10623621 (2000)
CC:

protein found in www.incyte.com-database
SP:

IF4N_HUMAN, P38919
SS:

SWISSPROT/TrEMBL
SI:

411 AA; 46817 Da; calculated pI: 6.30
SQ:

MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEK
PSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAV
QIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRA
IKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRIL
VKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREA
NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNREL
YIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab