Index 
Search
Download
Help
ASC_00354: Annexin A2
ID:

ASC_00354
AC:

354
CL:

ASC
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Annexin A2
Annexin II
Lipocortin II
Calpactin I heavy chain
Chromobindin 8
P36
Protein I
Placental anticoagulant protein IV
PAP-IV
GN:

ANXA2
ANX2
OS:

Homo sapiens (Human)
P1:

1533225 (1992)
P2:

1533225 (1992)
CC:

protein found in www.incyte.com-database
SP:

ANX2_HUMAN, P07355
SS:

SWISSPROT/TrEMBL
SI:

338 AA; 38429 Da; calculated pI: 7.56
SQ:

STVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILT
NRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGL
GTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAE
DGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDML
ESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDML
KIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab