Index 
Search
Download
Help
ASC_00352: Ataxin-1
ID:

ASC_00352
AC:

352
CL:

ASC
DT:

03-SEP-2003
NA:

Ataxin-1
Spinocerebellar ataxia type 1 protein
GN:

SCA1
ATX1
P1:

10556285 (1999)
P2:

10556285 (1999)
CC:

NM-interaction described in results-part of paper (not in abstract)
SP:

ATX1_HUMAN, P54253
SS:

SWISSPROT/TrEMBL
SI:

816 AA; 87051 Da; calculated pI: 8.49
SQ:

MKSNQERSNECLPPKKREIPATSRSSEEKAPTLPSDNHRVEGTAWLPGNPGGRGHGGGRH
GPAGTSVELGLQQGIGLHKALSTGLDYSPPSAPRSVPVATTLPAAYATPQPGTPVSPVQY
AHLPHTFQFIGSSQYSGTYASFIPSQLIPPTANPVTSAVASAAGATTPSQRSQLEAYSTL
LANMGSLSQTPGHKAEQQQQQQQQQQQQHQHQQQQQQQQQQQQQQQHLSRAPGLITPGSP
PPAQQNQYVHISSSPQNTGRTASPPAIPVHLHPHQTMIPHTLTLGPPSQVVMQYADSGSH
FVPREATKKAESSRLQQAIQAKEVLNGEMEKSRRYGAPSSADLGLGKAGGKSVPHPYESR
HVVVHPSPSDYSSRDPSGVRASVMVLPNSNTPAADLEVQQATHREASPSTLNDKSGLHLG
KPGHRSYALSPHTVIQTTHSASEPLPVGLPATAFYAGTQPPVIGYLSGQQQAITYAGSLP
QHLVIPGTQPLLIPVGSTDMEASGAAPAIVTSSPQFAAVPHTFVTTALPKSENFNPEALV
TQAAYPAMVQAQIHLPVVQSVASPAAAPPTLPPYFMKGSIIQLANGELKKVEDLKTEDFI
QSAEISNDLKIDSSTVERIEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSS
CCPERTSQLFDLPCSKLSVGDVCISLTLKNLKNGSVKKGQPVDPASVLLKHSKADGLAGS
RHRYAEQENGINQGSAQMLSENGELKFPEKMGLPAAPFLTKIEPSKPAATRKRRWSAPES
RKLEKSEDEPPLTLPKPSLIPQEVKICIEGRSNVGK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab