Index 
Search
Download
Help
ASC_00348: Fanconi anemia group G protein
ID:

ASC_00348
AC:

348
CL:

ASC
DT:

27-MAY-2003
NA:

Fanconi anemia group G protein
FACG protein
DNA-repair protein XRCC9
GN:

FANCG
XRCC9
OS:

Homo sapiens (Human)
P1:

11297559 (2001)
P2:

11297559 (2001)
SP:

FACG_HUMAN, O15287
SS:

SWISSPROT/TrEMBL
SI:

622 AA; 68475 Da; calculated pI: 5.32
SQ:

MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLRRQQLAQDALEGLRGLLHSLQGL
PAAVPVLPLELTVTCNFIILRASLAQGFTEDQAQDIQRSLERVLETQEQQGPRLEQGLRE
LWDSVLRASCLLPELLSALHRLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLL
LKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASGLC
PRPVLVQVYTALGSCHRKMGNPQRALLYLVAALKEGSAWGPPLLEASRLYQQLGDTTAEL
ESLELLVEALNVPCSSKAPQFLIEVELLLPPPDLASPLHCGTQSQTKHILASRCLQTGRA
GDAAEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFLEAAVALIQAGRAQDALTLCEEL
LSRTSSLLPKMSRLWEDARKGTKELPYCPLWVSATHLLQGQAWVQLGAQKVAISEFSRCL
ELLFRATPEEKEQGAAFNCEQGCKSDAALQQLRAAALISRGLEWVASGQDTKALQDFLLS
VQMCPGNRDTYFHLLQTLKRLDRRDEATALWWRLEAQTKGSHEDALWSLPLYLESYLSWI
RPSDRDAFLEEFRTSLPKSCDL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab