Index 
Search
Download
Help
ASC_00347: DNA-repair protein complementing XP-A cells
ID:

ASC_00347
AC:

347
CL:

ASC
DT:

26-MAY-2003
NA:

DNA-repair protein complementing XP-A cells
Xeroderma pigmentosum group A complementing protein
GN:

XPA
XPAC
OS:

Homo sapiens (Human)
P1:

9729238 (1998), 15087443 (2004)
P2:

9729238 (1998), 15087443 (2004)
SP:

XPA_HUMAN, P23025
PD:

1D4U, 1XPA
SS:

SWISSPROT/TrEMBL
SI:

273 AA; 31332 Da; calculated pI: 6.29
SQ:

MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMA
NVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNH
FDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETI
VHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab