Index 
Search
Download
Help
ASC_00340: POU domain, class 2, transcription factor 1
ID:

ASC_00340
AC:

340
CL:

ASC
DT:

26-MAY-2003
NA:

POU domain, class 2, transcription factor 1
Octamer-binding transcription factor 1
Oct-1
OTF-1
NF-A1
GN:

POU2F1
OTF1
OCT1
OS:

Homo sapiens (Human)
P1:

8754837 (1996)
P2:

8754837 (1996)
CC:

this NMTS is a close homologue (hssp >= 10) to NMTS found in literature
SP:

PO21_HUMAN, P14859
PD:

1CQT, 1E3O, 1GT0, 1HF0, 1OCT, 1POG, 1POU
SS:

SWISSPROT/TrEMBL
SI:

743 AA; 76386 Da; calculated pI: 6.34
SQ:

MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTS
LQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQ
LLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQDLQQLQ
QLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQGLLQAQNLLTQLPQQSQANLLQSQ
PSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRI
KLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENLSSDS
SLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEK
EVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSLVTSSAATTLTVSP
VLPLTSAAVTNLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSA
SETSTTQTTSTPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANASLAAMAAAAGLNP
SLMAPSQFAAGGALLSLNPGTLSGALSPALMSNSTLATIQALASGGSLPITSLDATGNLV
FANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASAGNSAPVASLHATSTSAESIQ
NSLFTVASASGAASTTTTASKAQ

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab