Index 
Search
Download
Help
ASC_00338: Replication protein A 32 kDa subunit
ID:

ASC_00338
AC:

338
CL:

ASC
DT:

26-MAY-2003
NA:

Replication protein A 32 kDa subunit
RP-A
RF-A
Replication factor-A protein 2
GN:

RPA2
RPA32
REPA2
OS:

Homo sapiens (Human)
CT:

HeLa cell
P1:

11268003 (2001), 8601405 (1996)
P2:

8601405 (1996), 9729238 (1998), 11268003 (2001)
CC:

sequence assumed to be that of 32kDa protein
SP:

RFA2_HUMAN, P15927
PD:

1DPU, 1L1O, 1QUQ
SS:

SWISSPROT/TrEMBL
SI:

270 AA; 29214 Da; calculated pI: 5.75
SQ:

MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLV
DEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGR
APISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVS
SIKQAVDFLSNEGHIYSTVDDDHFKSTDAE

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab