Index 
Search
Download
Help
ASC_00336: E6 protein
ID:

ASC_00336
AC:

336
CL:

ASC
DT:

26-MAY-2003
NA:

E6 protein
GN:

E6
OS:

human papillomavirus 16
CT:

esophageal carcinoma cells
P1:

11854902 (2001)
P2:

11854902 (2001)
SP:

VE6_HPV16, P03126
SS:

SWISSPROT/TrEMBL
SI:

158 AA; 19165 Da; calculated pI: 9.16
SQ:

MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIV
YRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPE
EKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab