Index 
Search
Download
Help
ASC_00335: E6 protein
ID:

ASC_00335
AC:

335
CL:

ASC
DT:

27-MAY-2003
NA:

E6 protein
GN:

E6
OS:

cottontail rabbit papillomavirus
P1:

2828659 (1988)
P2:

2828659 (1988)
SP:

VE6_CRPVK, P03127
SS:

SWISSPROT/TrEMBL
SI:

273 AA; 29702 Da; calculated pI: 4.37
SQ:

MENCLPRSLEKLQQILQISLEDLPFGCIFCGKLLGAAEKQLFKCTGLCIVWHKGWPYGTC
RDCTVLSCALDLYCHLALTAPALEAEALVGQEISSWFMRCTVCGRRLTIPEKIELRARNC
TLCCIDKGQYFQWRGHCSSCKLSDQGDLGGYPPSPGSRCGECDECCVPDLTHLTPVDLEE
LGLYPGPEGTYPDLVDLGPGVFGEEDEEGGGLFDSFEEEDPGPNQCGCFFCTSYPSGTGD
TDINQGPAGAAGIALQSDPVCFCENCINFTEFR

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab