Index 
Search
Download
Help
ASC_00333: Coat protein VP1
ID:

ASC_00333
AC:

333
CL:

ASC
DT:

26-MAY-2003
NA:

Coat protein VP1
OS:

polyomavirus
P1:

10873772 (2000)
P2:

10873772 (2000)
CC:

sequence taken from bovine polyomavirus
SP:

COA1_POVBO, P24848
SS:

SWISSPROT/TrEMBL
SI:

365 AA; 40468 Da; calculated pI: 5.81
SQ:

MSRMRKNMNPPKKGLKGQPSPVPKLIIKGGIEVLGLRTGPDSTTTIELFLNPRMGQSTES
EYYGFSDNQRGSTSRTDEDLISAELPRYSLGVVQLPLLNEKLTDDVLLMWEAVSCKTEVV
GVNTLTTCHGYKKRYSPSAGQGSAMPIEGINYHFFAVGGEPLEIQFICEDFKAPYHPTET
IVPPKDKLSNKSQVLDPTLKGILDKDGVYPVECWCPDPSKNENTRYFGTYTGGVSTPPVL
QFTNTVTTILLDENGVGPLCKADKLYITAADICGFLTQPNDQQQFRGLPRYMSVTLRKRL
VKNPYPIASILTSLFTNSLPPVTSQEMDKQVEEVRIYQGVEGLPGDPDMVRYINKFGQEE
TCIPK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab