Index 
Search
Download
Help
ASC_00314: TAT protein
ID:

ASC_00314
AC:

314
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

TAT protein
Transactivating regulatory protein
GN:

TAT
OS:

hiv-1
CT:

H9 cell,
P1:

2544227 (1989), 2406262 (1990)
P2:

2406262 (1990), 2544227 (1989)
SP:

TAT_HV1S3, P19552
SS:

SWISSPROT/TrEMBL
SI:

101 AA; 11489 Da; calculated pI: 8.90
SQ:

MEPVDPNLEPWKHPGSQPRTACTNCYCKKCCFHCQVCFITKGLGISYGRKKRRQRQRAPD
SSQNHQDSLSKQPSSQPRGDPTGPKESKKEVERETETDPLD

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab