Index 
Search
Download
Help
ASC_00313: High mobility group protein HMGI-C
ID:

ASC_00313
AC:

313
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

High mobility group protein HMGI-C
High mobility group AT-hook 2
GN:

HMGA2
HMGIC
OS:

Mus musculus (Mouse)
P1:

9989879 (1998), 7651535 (1995)
P2:

7651535 (1995), 9989879 (1998)
SP:

HMGC_MOUSE, P52927
SS:

SWISSPROT/TrEMBL
SI:

108 AA; 11806 Da; calculated pI: 10.63
SQ:

MSARGEGAGQPSTSAQGQPAAPVPQKRGRGRPRKQQQEPTCEPSPKRPRGRPKGSKNKSP
SKAAQKKAETIGEKRPRGRPRKWPQQVVQKKPAQETEETSSQESAEED

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab