Index 
Search
Download
Help
ASC_00299: Zinc finger protein 74
ID:

ASC_00299
AC:

299
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Zinc finger protein 74
hZNF7
GN:

ZNF74
OS:

Homo sapiens (Human)
P1:

8663113 (1996), 9346935 (1997)
P2:

8663113 (1996), 9346935 (1997)
SP:

ZN74_HUMAN, Q16587
SS:

SWISSPROT/TrEMBL
SI:

643 AA; 72027 Da; calculated pI: 8.90
SQ:

MEIPAPEPEKTALSSQDPALSLKENLEDISGWGLPEARSKESVSFKDVAVDFTQEEWGQL
DSPQRALYRDVMLENYQNLLALGPPLHKPDVISHLERGEEPWSMQREVPRGPCPEWELKA
VPSQQQGICKEEPAQEPIMERPLGGAQAWGRQAGALQRSQAAPGRRTCHGLGRPVEEFPL
RCPLFAQQRVPEGGPLLDTRKNVQATEGRTKAPARLCAGENASTPSEPEKFPQVRRQRGA
GAGEGEFVCGECGKAFRQSSSLTLHRRWHSREKAYKCDECGKAFTWSTNLLEHRRIHTGE
KPFFCGECGKAFSCHSSLNVHQRIHTGERPYKCSACEKAFSCSSLLSMHLRVHTGEKPYR
CGECGKAFNQRTHLTRHHRIHTGEKPYQCGSCGKAFTCHSSLTVHEKIHSGDKPFKCSDC
EKAFNSRSRLTLHQRTHTGEKPFKCADCGKGFSCHAYLLVHRRIHSGEKPFKCNECGKAF
SSHAYLIVHRRIHTGEKPFDCSQCWKAFSCHSSLIMHQRIHTGEKPYKCSECGRAFSQNH
CLIKHQKIHSGEKSFKCEKCGEMFNWSSHLTEHQRLHSEGKPLAIQFNKHLLSTYYVPGS
LLGAGDAGLRDVDPIDALDVAKLLCVVPPRAGRNFSLGSKPRN

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab