Index 
Search
Download
Help
ASC_00294: Tyrosine-protein kinase LYN
ID:

ASC_00294
AC:

294
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Tyrosine-protein kinase LYN
GN:

LYN
OS:

Homo sapiens (Human)
P1:

8612602 (1996)
P2:

8612602 (1996)
CC:

p53 and p56 isoforms
SP:

LYN_HUMAN, P07948
SS:

SWISSPROT/TrEMBL
SI:

511 AA; 58376 Da; calculated pI: 6.76
SQ:

GCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDP
EEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKL
NTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIK
HYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAWE
IPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDK
LVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERK
NYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFT
IKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWK
EKAEERPTFDYLQSVLDDFYTATEGQYQQQP

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab