Index 
Search
Download
Help
ASC_00293: Protein UL55
ID:

ASC_00293
AC:

293
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Protein UL55
GN:

UL55
OS:

hsv-2
P1:

9714248 (1989)
P2:

9714248 (1989)
SP:

UL55_HSV2H, P28281
SS:

SWISSPROT/TrEMBL
SI:

186 AA; 20418 Da; calculated pI: 9.35
SQ:

MTTTPLSNLFLRAPDITHVAPPYCLNATWQAENALHTTKTDPACLAARSYLVRASCSTSG
PIHCFFFAVYKDSQHSLPLVTELRNFADLVNHPPVLRELEDKRGGRLRCTGPFSCGTIKD
VSGASPAGEYTINGIVYHCHCRYPFSKTCWLGASAALQHLRSISSSGTAARAAEQRRHKI
KIKIKV

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab