Index 
Search
Download
Help
ASC_00292: Cell division control protein 6
ID:

ASC_00292
AC:

292
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Cell division control protein 6
GN:

CDC6
YJL194W
J0347
OS:

Saccharomyces cerevisiae (Baker's yeast)
P1:

8892760 (1996)
P2:

8892760 (1996)
SP:

CDC6_YEAST, P09119
SS:

SWISSPROT/TrEMBL
SI:

513 AA; 57969 Da; calculated pI: 9.49
SQ:

MSAIPITPTKRIRRNLFDDAPATPPRPLKRKKLQFTDVTPESSPEKLQFGSQSIFLRTKA
LLQKSSELVNLNSSDGALPARTAEYEQVMNFLAKAISEHRSDSLYITGPPGTGKTAQLDM
IIRQKFQSLPLSLSTPRSKDVLRHTNPNLQNLSWFELPDGRLESVAVTSINCISLGEPSS
IFQKIFDSFQDLNGPTLQIKNMQHLQKFLEPYHKKTTFVVVLDEMDRLLHANTSETQSVR
TILELFLLAKLPTVSFVLIGMANSLDMKDRFLSRLNLDRGLLPQTIVFQPYTAEQMYEIV
IQKMSSLPTIIFQPMAIKFAAKKCAGNTGDLRKLFDVLRGSIEIYELEKRFLLSPTRGSL
NSAQVPLTPTTSPVKKSYPEPQGKIGLNYIAKVFSKFVNNNSTRTRIAKLNIQQKLILCT
IIQSLKLNSDATIDESFDHYIKAITKTDTLAPLQRNEFLEICTILETCGLVSIKKTKCKG
KTKRFVDKIDVDLDMREFYDEMTKISILKPFLH

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab