Index 
Search
Download
Help
ASC_00290: Splicing factor, arginine/serine-rich 2
ID:

ASC_00290
AC:

290
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Splicing factor, arginine/serine-rich 2
Splicing factor SC35
SC-35
Splicing component, 35 kDa
PR264 protein
GN:

SFRS2
OS:

Homo sapiens (Human)
CT:

hl-60
P1:

10025665 (1999), 12581738 (2003)
P2:

10025665 (1999), 12581738 (2003)
SP:

SFR2_HUMAN, Q01130
SS:

SWISSPROT/TrEMBL
SI:

221 AA; 25547 Da; calculated pI: 11.88
SQ:

MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYRRVGDVYIPRDRYTKESRGFAFV
RFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSR
SPRRRRRSRSRSRSRSRSRSRSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSR
SRSRSRSRSRSPPPVSKRESKSRSRSKSPPKSPEEEGAVSS

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab