Index 
Search
Download
Help
ASC_00289: Protein Tyrosine Phosphatase (special splicing product S4)
ID:

ASC_00289
AC:

289
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Protein Tyrosine Phosphatase (special splicing product S4)
OS:

Homo sapiens (Human)
P1:

8900155 (1996)
P2:

8900155 (1996)
SP:

PTN2_HUMAN, P17706
PD:

1L8K
SS:

SWISSPROT/TrEMBL
SI:

415 AA; 48528 Da; calculated pI: 8.65
SQ:

MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA
FDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWRLFFQQNAL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab