Index 
Search
Download
Help
ASC_00288: Nuclear autoantigen Sp-100
ID:

ASC_00288
AC:

288
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Nuclear autoantigen Sp-100
Speckled 100 kDa
Nuclear dot-associated Sp100 protein
Lysp100b
GN:

SP100
CT:

b-cell
P1:

11594453 (2001)
P2:

11594453 (2001)
SP:

SP10_HUMAN, P23497
PD:

1H5P
SS:

SWISSPROT/TrEMBL
SI:

879 AA; 100304 Da; calculated pI: 8.49
SQ:

MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRN
KVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRNLVPVQRVVYNVLSELEKTFNLP
VLEALFSDVNMQEYPDLIHIYKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENS
FRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQ
KAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEK
PFSNSKVECQAQARTHHNQASDIIVISSEDSEGSTDVDEPLEVFISAPRSEPVINNDNPL
ESNDEKEGQEATCSRPQIVPEPMDFRKLSTFRESFKKRVIGQDHDFSESSEEEAPAEASS
GALRSKHGEKAPMTSRSTSTWRIPSRKRRFSSSDFSDLSNGEELQETCSSSLRRGSGSQP
QEPENKKCSCVMCFPKGVPRSQEARTESSQASDMMDTMDVENNSTLEKHSGKRRKKRRHR
SKVNGLQRGRKKDRPRKHLTLNNKVQKKRWQQRGRKANTRPLKRRRKRGPRIPKDENINF
KQSELPVTCGEVKGTLYKERFKQGTSKKCIQSEDKKWFTPREFEIEGDRGASKNWKLSIR
CGGYTLKVLMENKFLPEPPSTRKKRILESHNNTLVDPCEEHKKKNPDASVKFSEFLKKCS
ETWKTIFAKEKGKFEDMAKADKAHYEREMKTYIPPKGEKKKKFKDPNAPKRPPLAFFLFC
SEYRPKIKGEHPGLSIDDVVKKLAGMWNNTAAADKQFYEKKAAKLKEKYKKDIAAYRAKG
KPNSAKKRVVKAEKSKKKKEEEEDEEDEQEEENEEDDDK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab