Index 
Search
Download
Help
ASC_00286: Zinc finger protein 384
ID:

ASC_00286
AC:

286
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Zinc finger protein 384
Nuclear matrix transcription factor 4
Cas-associated zinc finger protein
GN:

ZNF384
NMP4
CIZ
OS:

Rattus norvegicus (Rat)
CT:

osteoblast
P1:

11149472 (2001)
P2:

12067068 (2001), 12052465 (2002), 11149472 (2001)
CC:

binding to DNA not required for NM-interaction
SP:

Z384_RAT, Q9EQJ4
SS:

SWISSPROT/TrEMBL
SI:

579 AA; 63068 Da; calculated pI: 9.22
SQ:

MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVS
LSSGISMDTESKSEQLTPHSQASVTQNITVVPVPSTGLMTAGVSCSQRWRREGSQSRGPG
LVITSPSGSLVTTASSAQTFPISTPMIVSALPPGSQALQVVPDLSKKVASTLTEEGGGGG
GGGGTVAPPKPPRGRKKKRMLESGLPEMNDPYVLAPGDDDDHQKDGKTYRCRMCSLTFYS
KSEMQIHSKSHTETKPHKCPHCSKTFANSSYLAQHIRIHSGAKPYSCNFCEKSFRQLSHL
QQHTRIHSKMHTETIKPHKCPHCSKTFANTSYLAQHLRIHSGAKPYNCSYCQKAFRQLSH
LQQHTRIHTGDRPYKCAHPGCEKAFTQLSNLQSHRRQHNKDKPFKCHNCHRAYTDAASLE
AHLSTHTVKHAKVYTCTICSRAYTSETYLMKHMRKHNPPDLQQQVQAAAAAAAVAQAQAQ
AQAQAQAQAQAQAQAQAQAQAQASQASQQQQQQQPPPPQPPHFQSPGAAPQGGGGGDSNQ
NPPPQCSFDLTPYKPAEHHKDICLTVTTSTIQVEHLASS

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab