Index 
Search
Download
Help
ASC_00282: CCAAT/enhancer binding protein beta
ID:

ASC_00282
AC:

282
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

CCAAT/enhancer binding protein beta
C/EBP beta
Interleukin-6-dependent binding protein
IL-6DBP
Liver-enriched transcriptional activator
LAP
Silencer factor B
SF-B
C/EBP-related protein 2
GN:

CEBPB
SFB
CRP2
OS:

Rattus norvegicus (Rat)
CT:

hepatocyte, liver
P1:

12095231 (2002), 11023646 (2000), 14661739 (2003)
P2:

11023646 (2000), 12095231 (2002), 14661739 (2003)
SP:

CEBB_RAT, P21272
SS:

SWISSPROT/TrEMBL
SI:

297 AA; 31467 Da; calculated pI: 8.78
SQ:

MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERA
IDFSPYLEPLAPAAADFAAPAPAHHDFLSDLFADDYGAKPSKKPSDYGYVSLGRAGAKAA
PPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLST
SSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKAVDKLSDEYKMRRERNNIAVRKS
RDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab