Index 
Search
Download
Help
ASC_00279: Runt-related transcription factor 3
ID:

ASC_00279
AC:

279
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Runt-related transcription factor 3
Core-binding factor, alpha 3 subunit
CBF-alpha 3
Acute myeloid leukemia 2 protein
Oncogene AML-2
Polyomavirus enhancer binding protein 2 alpha C subunit
PEBP2-alpha C
PEA2-alpha C
SL3-3 enhancer factor 1 alpha C subunit
SL3/AKV core-binding factor alpha C subunit
GN:

RUNX3
CBFA3
AML2
PEBP2A3
P1:

9632801 (1998), 10559245 (1999)
P2:

9632801 (1998), 10559245 (1999)
CC:

this NMTS is a close homologue (hssp >= 10) to NMTS found in literature
SP:

RUN3_HUMAN, Q13761
SS:

SWISSPROT/TrEMBL
SI:

415 AA; 44306 Da; calculated pI: 9.53
SQ:

MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLA
DHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAE
LRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREP
RRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELN
PFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPAT
SRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRM
LASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab