Index 
Search
Download
Help
ASC_00277: Splicing factor, proline-and glutamine-rich
ID:

ASC_00277
AC:

277
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Splicing factor, proline-and glutamine-rich
Polypyrimidine tract-binding protein-associated splicing factor
PTB-associated splicing factor
PSF
DNA-binding P52/P100 complex, 100 kDa subunit
GN:

SFPQ
PSF
OS:

Homo sapiens (Human)
P1:

10653975 (2000)
P2:

10653975 (2000)
SP:

SFPQ_HUMAN, P23246
SS:

SWISSPROT/TrEMBL
SI:

707 AA; 76064 Da; calculated pI: 9.45
SQ:

MSRDRFRSRGGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPI
PPPPPHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPG
VGSAPPASSSAPPATPPTSGAPPGSGPGPTPTPPPAVTSAPPGAPPPTPPSSGVPTTPPQ
AGGPPPPPAAVPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE
PRGGRQHHPPYHQQHHQGPPPGGPGGRSEEKISDSEGFKANLSLLRRPGEKTYTQRCRLF
VGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGR
QLRVRFATHAAALSVRNLSPYVSNELLEEAFSQFGPIERAVVIVDDRGRSTGKGIVEFAS
KPAARKAFERCSEGVFLLTTTPRPVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRF
AQHGTFEYEYSQRWKSLDEMEKQQREQVEKNMKDAKDKLESEMEDAYHEHQANLLRQDLM
RRQEELRRMEELHNQEMQKRKEMQLRQEEERRRREEEMMIRQREMEEQMRRQREESYSRM
GYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGS
DMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab