Index 
Search
Download
Help
ASC_00272: Ribonuclease H
ID:

ASC_00272
AC:

272
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Ribonuclease H
RNase H
GN:

RNH1
YMR234W
YM9959.16
OS:

Saccharomyces cerevisiae (Baker's yeast)
P1:

2172263 (1990)
P2:

2172263 (1990)
CC:

sequence only 39kDa instead of 70kDa as it is said in paper
SP:

RNH1_YEAST, Q04740
PD:

1QHK
SS:

SWISSPROT/TrEMBL
SI:

348 AA; 39387 Da; calculated pI: 9.35
SQ:

MARQGNFYAVRKGRETGIYNTWNECKNQVDGYGGAIYKKFNSYEQAKSFLGQPNTTSNYG
SSTHAGGQVSKPHTTQKRVHRRNRPLHYSSLTSSSACSSLSSANTNTFYSVKSNVPNIES
KIFNNWKDCQAYVKHKRGITFKKFEDQLAAENFISGMSAHDYKLMNISKESFESKYKLSS
NTMYNKSMNVYCDGSSFGNGTSSSRAGYGAYFEGAPEENISEPLLSGAQTNNRAEIEAVS
EALKKIWEKLTNEKEKVNYQIKTDSEYVTKLLNDRYMTYDNKKLEGLPNSDLIVPLVQRF
VKVKKYYELNKECFKNNGKFQIEWVKGHDGDPGNEMADFLAKKGASRR

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab