Index 
Search
Download
Help
ASC_00270: Polyhedrin
ID:

ASC_00270
AC:

270
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Polyhedrin
Major occlusion protein
GN:

PH
P29
POLH
OS:

AcMNPV
P1:

3055664 (1988)
P2:

3055664 (1988)
SP:

PYHD_NPVAC, P04871
SS:

SWISSPROT/TrEMBL
SI:

245 AA; 28609 Da; calculated pI: 5.82
SQ:

MPDYSYRPTIGRTYVYDNKYYKNLGAVIKNAKRKKHFAEHEIEEATLDPLDNYLVAEDPF
LGPGKNQKLTLFKEIRNVKPDTMKLVVGWKGKEFYRETWTRFMEDSFPIVNDQEVMDVFL
VVNMRPTRPNRCYKFLAQHALRCDPDYVPHDVIRIVEPSWVGSNNEYRISLAKKGGGCPI
MNLHSEYTNSFEQFIDRVIWENFYKPIVYIGTDSAEEEEILLEVSLVFKVKEFAPDAPLF
TGPAY

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab