Index 
Search
Download
Help
ASC_00262: Nuclear factor I-A
ID:

ASC_00262
AC:

262
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Nuclear factor I-A
Nuclear factor 1
NF-I
CCAAT box-binding transcription factor
CTF
TGGCA-binding protein
CCAAT-box binding transcription factor
GN:

CNFI-A
OS:

Gallus gallus (Chicken)
CT:

erythroid cell
P1:

8089200 (1994)
P2:

8089200 (1994)
CC:

NF1
SP:

Q90925
SS:

SWISSPROT/TrEMBL
SI:

509 AA; 55909 Da; calculated pI: 8.67
SQ:

MYSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKEEERAVKDEL
LSEKPEVKQKWASRLLAKLRKDIRPEFREDFVLTVTGKKPPCCVLSNPDQKGKMRRIDCL
RQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHIGVSVKELDLYLA
YFVHAADSSQSESPSQPSEADIKDQPENGHLGFQDSFVTSGVFSVTELVRVSQTPIAAGT
GPNFSLSDLESSSYYSMSPGAMRRSLPSTSSTSSTKRIKSVEDEMDSPGEEPFYTSQGRS
PGSGSQSSGWHEVEPGMPSPTALKKSEKSGFSSPSPSQTSSLGTAFTQHHRPVITGPRAS
PHATPSTLHFPTSPIIQQPGPYFSHPAIRYHPQETLKEFVQLVCPDAGQQAGQVGFLNPN
GSSQGKVHNPFLPTPMLPPPPPPPMARPVPLPVPDTKPPTTSTEGGATSPTSPTYSTPST
SPANRFVSVGPRDPSFVNIPQQTQSWYLG

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab