Index 
Search
Download
Help
ASC_00261: Heat shock protein 23
ID:

ASC_00261
AC:

261
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Heat shock protein 23
GN:

HSP23
CG4463
OS:

Drosophila Melanogaster (Fruit fly)
P1:

6793585 (1981)
P2:

6793585 (1981)
SP:

HS23_DROME, P02516
SS:

SWISSPROT/TrEMBL
SI:

186 AA; 20606 Da; calculated pI: 5.55
SQ:

MANIPLLLSLADDLGRMSMVPFYEPYYCQRQRNPYLALVGPMEQQLRQLEKQVGASSGSS
GAVSKIGKDGFQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYAL
PPGYEADKVASTLSSDGVLTIKVPKPPAIEDKGNERIVQIQQVGPAHLNVKENPKEAVEQ
DNGNDK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab