Index 
Search
Download
Help
ASC_00260: Heat shock protein 26
ID:

ASC_00260
AC:

260
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Heat shock protein 26
GN:

HSP26
CG4183
OS:

Drosophila Melanogaster (Fruit fly)
P1:

6793585 (1981)
P2:

6793585 (1981)
SP:

HS26_DROME, P02517
SS:

SWISSPROT/TrEMBL
SI:

208 AA; 22968 Da; calculated pI: 7.12
SQ:

MSLSTLLSLVDELQEPRSPIYELGLGLHPHSRYVLPLGTQQRRSINGCPCASPICPSSPA
GQVLALRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEE
RQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQ
VGPAHLNVKANESEVKGKENGAPNGKDK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab