Index 
Search
Download
Help
ASC_00259: Heat shock protein 27
ID:

ASC_00259
AC:

259
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Heat shock protein 27
GN:

HSP27
CG4466
OS:

Drosophila Melanogaster (Fruit fly)
P1:

6793585 (1981)
P2:

6793585 (1981)
SP:

HS27_DROME, P02518
SS:

SWISSPROT/TrEMBL
SI:

213 AA; 23590 Da; calculated pI: 6.90
SQ:

MSIIPLLHLARELDHDYRTDWGHLLEDDFGFGVHAHDLFHPRRLLLPNTLGLGRRRYSPY
ERSHGHHNQMSRRASGGPNALLPAVGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHE
EREDGHGMIQRHFVRKYTLPKGFDPNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQ
QTGPAHLSVKAPAPEAGDGKAENGSGEKMETSK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab