Index 
Search
Download
Help
ASC_00258: Heat shock protein 68
ID:

ASC_00258
AC:

258
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Heat shock protein 68
GN:

HSP68
CG5436
OS:

Drosophila Melanogaster (Fruit fly)
P1:

6793585 (1981)
P2:

6793585 (1981)
SP:

HS68_DROME, O97125
SS:

SWISSPROT/TrEMBL
SI:

635 AA; 69665 Da; calculated pI: 5.63
SQ:

MPAIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP
KNSVFDAKRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEISSMV
LTKMKETAEAYLGTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALAY
GLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVNHFA
EEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEASLEIDALYEGHDFYSKVSRARF
EELCGDLFRNTLEPVEKALKDAKMDKSQIHDIVLVGGSTRIPKVQNLLQNFFGGKTLNLS
INPDEAVAYGAAIQAAILSGDKSSEIKDVLLVDVAPLSLGIETAGGVMTKLIERNSRIPC
KQSKTFTTYADNQPAVTIQVFEGERALTKDNNVLGTFDLTGVPPAPRGVPKIDVTFDLDA
NGILNVTAKEQGTGNAKNITIKNDKGRLSQADIDRMLSEAEKYAEEDERHRQRIAARNQL
ETYLFGVKEAAENGGDRISAADKSSIVERCSEAMKWLDSNTTAEKEEYEYKLKELEQFCS
PIMTKMHKGGGDGQQAPNFGQQAGGYKGPTVEEVD

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab