Index 
Search
Download
Help
ASC_00250: Keratin, type I cytoskeletal 12
ID:

ASC_00250
AC:

250
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Keratin, type I cytoskeletal 12
Cytokeratin 12
K12
CK 12
GN:

KRT12
OS:

Bos taurus (Bovine)
CT:

corneal epithelial cell
P1:

8921234 (1996)
P2:

8921234 (1996)
CC:

sequence taken from human
SP:

K1CL_HUMAN, Q99456
SS:

SWISSPROT/TrEMBL
SI:

494 AA; 53452 Da; calculated pI: 4.70
SQ:

MDLSNNTMSLSVRTPGLSRRLSSQSVIGRPRGMSASSVGSGYGGSAFGFGASCGGGFSAA
SMFGSSSGFGGGSGSSMAGGLGAGYGRALGGGSFGGLGMGFGGSPGGGSLGILSGNDGGL
LSGSEKETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRGTGTADASQSDYSKYY
PLIEDLRNKIISASIGNAQLLLQIDNARLAAEDFRMKYENELALRQGVEADINGLRRVLD
ELTLTRTDLEMQIESLNEELAYMKKNHEDELQSFRVGGPGEVSVEMDAAPGVDLTRLLND
MRAQYETIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQ
SQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQVRADAERQNVDHQRLLNVKA
RLELEIETYRRLLDGEAQGDGLEESLFVTDSKSQAQSTDSSKDPTKTRKIKTVVQEMVNG
EVVSSQVQEIEELM

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab