Index 
Search
Download
Help
ASC_00236: SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily B member 1
ID:

ASC_00236
AC:

236
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily B member 1
Integrase interactor 1 protein
hSNF5
BAF47
GN:

SMARCB1
SNF5L1
INI1
OS:

Homo sapiens (Human)
P1:

9128241 (1997)
P2:

9128241 (1997)
CC:

SNF5 is a component of the human SWI/SNF complex
SP:

SNF5_HUMAN, Q12824
SS:

SWISSPROT/TrEMBL
SI:

385 AA; 44067 Da; calculated pI: 5.86
SQ:

MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEER
KKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYL
REQKAKRNSQWVPTLSNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA
SQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASA
IRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSE
LGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAE
MEKKIRDQDRNTRRMRRLANTGPAW

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab